COFORGE
COFORGE LIMITEDInformation Technology
LTP
1,805.4
CHG · %
+29.4 (+1.66%)
VOL · TODAY
16.89L
PREV CLOSE
1,776
Today's range1,783.1 · 1,822.6
1,805.4
52-week range1,008.1 · 1,989.7
1,805.4
Loading candles…
Coforge is an IT services company specializing in end-to-end software solutions and digital services, including AI-led engineering, cloud modernization, data readiness, and agentic services. It delivers modernization and transformation services with deep domain expertise primarily in the banking, insurance, and travel sectors. The company operates globally, maintaining twenty-five delivery centers across ten countries and subsidiaries in the United States, Singapore, Australia, the United Kingdom, Germany, and Thailand. Coforge serves prominent clients such as British Airways, ING Group, SEI Investments, Sabre, and SITA, and holds business partnerships with large IT companies worldwide. It is recognized as one of the top-20 Indian software exporters and has a presence across North America, Europe, Asia-Pacific, and the Middle East.
- MomentumLong BuildupRise in price with increasing open interest — indicates strong bullish momentum
- MomentumRSI OverboughtRSI above threshold — indicates overbought conditions, possible pullback ahead
- Market MoversOpen=LowStocks opening at the day’s low — potential early intraday buying strength
- Market MoversTop GainersStocks with the highest price gains during the session — reflects strong buying activity
This page is a live market overview for COFORGE LIMITED (COFORGE) on the NSE. As a listed security, COFORGE LIMITED is tracked in the Information Technology segment of the Indian cash market and is widely followed for price discovery, liquidity and sector exposure. Use this overview to review price action, session ranges and derivatives context for COFORGE before placing trades on tick2trade.
As of the latest feed, COFORGE last traded at ₹1,805.4 on NSE, up ₹29.4 (1.66%) from the previous close of ₹1,776. Today's session range is ₹1,783.1 – ₹1,822.6, against a 52-week band of ₹1,008.1 – ₹1,989.7. Traded volume today stands at 16.89L shares.
The overview consolidates an interactive price chart with multiple time ranges, five-level bid and ask depth, a near-the-money option chain snapshot, recent market headlines, upcoming corporate events for COFORGE in one place so you do not need multiple screens during the session. Day and 52-week ranges help you judge whether COFORGE is trading near support, resistance or the middle of its recent band. Volume and depth, when available, add context on how aggressively the name is being bought or sold.
Equity overview pages are built for investors who want a single reference for COFORGE LIMITED before reading news, checking results or sizing a position. Corporate events and headlines in the side column surface catalysts that may explain sudden moves in COFORGE. Related stocks in the same sector appear at the bottom of the page for quick peer comparison.
For a full option chain with greeks, open-interest bias, max pain and multi-leg strategy tools, open the tick2trade terminal or visit the dedicated COFORGE option chain page linked from this overview.
// similar in information technology279 total
TCSINFYHCLTECHWIPROTECHMLTMOFSSPERSISTENTMPHASISLTTSTATATECHHEXTIKSNETWEBTATAELXSIAFFLESAGILITYKPITTECHIDREAMAMAGI
show more (+259)show less
FRACTALBBOXE2EZENSARTECHRATEGAININTELLECTCYIENTSONATSOFTWBSOFTTANLANEWGENASMTECLATENTVIEWEBGNGHAPPSTMNDSRPTECHMASTEKMAPMYINDIADATAMATICSEMUDHRACAPILLARYAURIONPROMOSCHIP63MOONSTECHNVISNRSYSTEMSSASKENBLSEZAGGLESILVERTUCRAMCOSYSMOBAVENUEPROTEANNELCOSAKSOFTAXISOLBLUECLOUDSBCGKODYTECHNUCLEUSCEINSYSAURUMHYPERSOFTMCLOUDACCELYAINFOBEANDSSLDIGITIDEDLINKINDIAGENESYSIVALUEIZMONINSYSEXPLEOSOLORIENTTECHTACUNIECOMCONTROLPREXCELSOFTTVSELECTBGDLSAHANAQUICKHEALSUBEXLTDMETAPANACHEXCHANGINGXTRANETKELLTONTECINNOVANAKSOLVESVAKRANGEEADSLONWARDTECRNITAIMINDTECKSOFTTECHDCI3IINFOLTDCSMTERASOFTSIGMAIRISWORKMATESCOVANCEXTGLOBALTECHDCYBERTECHDIGISPICEBCCFUBAINSPIRISYSSATTRIXSOTEFINHCLINSYSVGINFOTECHABMKNOOPTIVALUESYSTANGOVERTOZACSTECHOMEGAINAEIMGOLDTECHEPWINDIAALLETECALPHALOGICEMPOWERFCSSOFTCNINFOTECHEQUIPPPINFINITYSMARTLINKESCONETASMSACESOFTTECHLABSINTENTECHFIDELGTTDATADRCSYSTEMSAIRANATISHAYAVANCEVIRINCHITRIGYNDCMDEVITSHRAAITECHGENXAIENFUSENBLCANARYSSECMARKAZTECELNETENSERRICHAISERAXELPMOCVLEGOVWEPSOLNGVPTECHMOBILISEROXHITECHPRARUHMGSLJAGSONSERGSTLMARUSHIKAREGANTOTITANINCRSLATHENAGLOBITSCGVAKDELAPLEXCRANESSOFTRSSOFTWARECALSOFTCTESLONECURAAACCELRIDDHICORPODIGMATRUSTSGLRESSECURKLOUDIDENTIXWEBPARAMATRIXARISINTSAGARSOFTEDVENSWAHGMSYNOPTICSODYSSEYNEWJAISAORCHASPADROITINFOAEONXDIGISOFCOMSTARCOMVEDAVAAGSATECHB2BSOFTNETLINKLEENEEPCSUSGTECHRAMINFOACCEDEREGSS7TECACCELERATEFINELINEIECEDUBODHTREECEREBRAINTMUDUNURUSYLPHMINDPOOLJUNETAKYONTELECANORMICROPROECSYUDIZNEWMKTAVEGSTLVERTEXPLUSOCTAWARESENINFOTRIDHYAVAMAACIININFRONICSCOSYNRESPONSINFCLIOINFOHITKITGLONIKSTECHCONTCHMPANABYTEUNITEDINTQUADPROGROARCVCUACEENGITECSOUTHERNINSVAMSOFIPOWERCOMPINFOEKENNISCOMPUPNEUPHORIAITUPROTECHRCCEMENMAHAVEEROONEHINDBIOFIRSTFINSPACEINCUBANIHARINFWITSJOINTECAEDTRANWAY21SPARADJIASESHACHALBGLOBALQUINTEGRAINTEGHITTSPIRITUALWOMENNETOMNIAXPFLINFOTCVIRGOGLOB4THGENBARONINF
Frequently asked questions
- What is the current price of COFORGE?
- COFORGE last traded at ₹1,805.4 on NSE. The previous close was ₹1,776. Prices refresh throughout market hours on this overview page.
- What is today's trading range for COFORGE?
- The session low is ₹1,783.1 and the session high is ₹1,822.6. The 52-week range spans ₹1,008.1 to ₹1,989.7, giving longer-term context for today's move.
- Where can I see the COFORGE option chain?
- A mini option chain appears in the right column when derivatives data is available. For the full chain with greeks, max pain and PCR, visit the dedicated COFORGE option chain page or open tick2trade.
- What data is shown on the COFORGE LIMITED overview page?
- The page includes live LTP, day and 52-week ranges, traded volume, an interactive price chart, market depth, recent news, corporate events and related stocks in the same sector.
- Which sector is COFORGE LIMITED in?
- COFORGE LIMITED is tracked in the Information Technology segment on NSE. Use the related-stocks section at the bottom of this page to compare peers in the same industry cluster.
- Is tick2trade free to use for COFORGE quotes?
- Yes — this overview page is free to access. Live prices, charts and the panels on this page do not require a login. Advanced execution, strategy building and full-depth analytics are available in the tick2trade terminal.